TopDog Law logo

Senior Front-End Engineer (Next.js)

TopDog Law
Department:React Lead
Type:REMOTE
Region:USA
Location:United States
Experience:Mid-Senior level
Estimated Salary:$120,000 - $160,000
Skills:
REACTNEXTJSTYPESCRIPTJAVASCRIPTCSSSANITYFIGMAGITVERCELCLOUDFLARETAILWINDSTORYBOOKRESTGRAPHQLSEOPERFORMANCEUXANALYTICS
Share this job:

Job Description

Posted on: January 10, 2026

TopDog Law. Who We Are. TopDog Law is one of the fastest-growing law firms in the U.S., founded in 2018 by James Helm and achieving 200–300% year-over-year growth. Ranked No. 149 on the Inc. 5000 list (an annual ranking of the 5000 fastest-growing privately held companies in the US), we combine our world-class legal expertise, top-tier technology, data-driven decision-making, and a culture rooted in speed, accountability, and teamwork. We hire people who are hungry to learn, eager to innovate, and motivated to deliver exceptional results. As we continue expanding into new markets and evolving our capabilities, we’re focused on building high-performance teams that can scale with our growth. Our fast-paced environment rewards problem solvers, self-starters, and individuals who thrive in a culture of continuous improvement. If you’re energized by rapid growth, meaningful impact, and endless opportunities to advance your career, TopDog Law is the place to do it. We’re building something different, and we’re looking for people who want to be part of a firm that’s disrupting the legal industry at an elite level. The Big Picture We are rebuilding our entire web experience using Next.js, a scalable component system, and an architecture built for speed, SEO, and conversion. As a Senior Front-End Engineer, you will be the Director of Web Development’s primary technical partner. You will build the components, templates, and user experiences that become the backbone of our marketing engine. This role is for someone who loves clean, modern front-end engineering, cares deeply about performance, and wants to ship work that drives the business forward. What You'll DoBuilding the Platform

  • Build responsive, accessible, and reusable front-end components in React/Next.js
  • Translate Figma designs into clean, production-ready interfaces
  • Implement page templates, modules, and content-driven layouts tied to a headless CMS (Sanity)
  • Integrate content from Sanity into Next.js App Router using Server Components, route-level data fetching, and smart caching
  • Build high-conversion marketing and intake flows: landing pages, FAQs, and lead forms

CMS & Content Modeling (Sanity)

  • Design and implement schemas for pages, sections, FAQs, forms, and reusable content blocks
  • Build robust GROQ (Graph-Relational Object Queries) queries and utilities for fetching content in Next.js Server Components
  • Implement preview and draft/live workflows so editors can safely preview content before publishing
  • Support migration of existing content (e.g., from WordPress) into other CMS where appropriate
  • Collaborate with marketing/content teams to ensure content models support their workflows without compromising performance or maintainability

Performance & SEO Optimization

  • Optimize Core Web Vitals (LCP, INP, CLS) and mobile performance
  • Keep Lighthouse performance/SEO scores consistently high
  • Improve image loading, font strategies, caching, and bundle weight
  • Ensure code is structured for speed, clarity, and maintainability

Conversion-Focused Development

  • Build high-intent landing pages and multi-step lead flows
  • Implement dynamic modules (FAQs, testimonials, results, attorney profiles)
  • Support A/B test variants and rapid experimentation cycles
  • Work closely with UX to refine and iterate based on behavioral insights

Analytics & Tracking Implementation

  • Implement event tracking for forms, CTAs, scroll behavior, and funnels
  • Work with decision science to validate that tracking fires cleanly
  • Support DataLayer and GTM integrations where needed

Design System & Code Quality

  • Help create and maintain a scalable design system with well-structured components
  • Participate in code reviews and contribute to engineering standards
  • Write clear, maintainable code with documentation where appropriate

Collaboration & Communication

  • Work closely with the Director of Web Development on architecture and execution
  • Partner with the UX designer, creative team, and marketing teams
  • Communicate technical decisions clearly to non-technical stakeholders

What You Bring

  • 4+ years of front-end development experience
  • Strong proficiency in React and Next.js (App Router experience is a plus)
  • Proficiency in TypeScript, modern JavaScript (ES6+), and modern CSS
  • Experience working with at least one headless CMS; Sanity experience preferred
  • Experience consuming and integrating REST or GraphQL APIs (Application Programming Interfaces)
  • Proven ability to translate Figma designs into pixel-accurate, production-ready builds
  • Solid understanding of web performance, Core Web Vitals, and how to build fast pages in practice
  • Comfort working in Git with modern development workflows

Nice-to-Have Experience

  • Experience with Storybook or component documentation tools
  • Hands-on experience with Sanity (schemas, GROQ, preview setups, content workflows)
  • Experience with Tailwind CSS or another utility-first CSS approach
  • Experience with A/B testing and experiment-driven development
  • Experience deploying and optimizing Next.js apps on Vercel
  • Experience configuring Cloudflare for DNS (Domain Name System), caching, and WAF (Web Application Firewall)
  • Exposure to legal, healthcare, or other compliance-sensitive industries
  • Experience with analytics and marketing tooling (e.g., GA4, GTM, call tracking, lead attribution)
  • Ability to provide thoughtful input on UX or design decisions

Why TopDog Law Is The Place To Be

  • Join the fastest-growing law firm in the U.S. and be part of a team driven by momentum, innovation, and real impact. 🚀
  • Work fully remote from anywhere, supported by a high-performance culture built on speed, accountability, and results. 💻
  • Do meaningful work that directly contributes to firm growth, client outcomes, and operational excellence.
  • Grow your career quickly with real opportunities for advancement, we promote from within. 🪜
  • Thrive in a culture of innovation focused on continuous improvement, collaboration, and high-quality execution.
  • Benefit from leadership that invests heavily in people, technology, training, and long-term success. 🖥️
  • Earn competitive compensation and strong benefits, including comprehensive medical, dental, vision, life, and protection plans. 💵
  • Receive a 4% 401(k) company match, helping you build long-term financial security from day one. 💰
  • Access company-paid holidays, two floating holidays, and five paid sick days (with rollover up to 10 days).
  • Enjoy generous paid time off:
  • 120 hours in year one
  • 160 hours beginning your second anniversary
  • 200 hours annually starting your fifth anniversary
Originally posted on LinkedIn

Apply now

Please let the company know that you found this position on our job board. This is a great way to support us, so we can keep posting cool jobs every day!

ReactRemoteJobs.com logo

ReactRemoteJobs.com

Get ReactRemoteJobs.com on your phone!